PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.251220.1
Common NameCsa_3G178570, LOC101206165
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family bHLH
Protein Properties Length: 171aa    MW: 19485.6 Da    PI: 9.2523
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.251220.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH30.47.1e-10149454
                    HHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
             HLH  4 ahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                    +h erEr+RR+++   +  Lr+llP  +   ++K   ++    Av+YIk+ 
  Cucsa.251220.1  1 MHRERERQRRQEMGALYMSLRTLLPLEF--IKGKRAISDQMNGAVNYIKHQ 49
                    59************************65..*******************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088811.877149IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474592.62E-10170IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.101.1E-6269IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000106.5E-7249IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003530.0032355IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
MHRERERQRR QEMGALYMSL RTLLPLEFIK GKRAISDQMN GAVNYIKHQE KKIKEIEAKR  60
DELKKMNNSS NFERSKLEEI PNCSFKISCF DGGVVEILIT TIGFHGFPLS RILKVVVEQG  120
LEVIRCGSSI INHKSIHTIQ IEVNDPTSLD LAELGNKLRE AVPLLRQVTD *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818481e-172LN681848.1 Cucumis melo genomic scaffold, anchoredscaffold00006.
GenBankLN7132601e-172LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004148118.11e-121PREDICTED: transcription factor bHLH118-like
TrEMBLA0A0A0LB701e-121A0A0A0LB70_CUCSA; Uncharacterized protein
STRINGPOPTR_0015s14070.13e-46(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF79233125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25400.11e-24bHLH family protein
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]